PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GRMZM2G070034_P01
Common NameMADS76, si486022a09, ZEAMMB73_646271
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Tripsacinae; Zea
Family MIKC_MADS
Protein Properties Length: 224aa    MW: 25660.3 Da    PI: 9.8015
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GRMZM2G070034_P01genomeMaizeSequenceView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.83.2e-29959151
                       S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
             SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                       krien + rqvtfskRrng+lKKA+ELSvLCdaev +++fs++gklye++s
  GRMZM2G070034_P01  9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVVFSPRGKLYEFAS 59
                       79***********************************************86 PP

2K-box64.83.1e-2278171598
              K-box   5 sgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                         ++++ +++ ++ + ++  L +++e L++++R +lGe+Le++s++eL++Le +L ksl  iR kK++ll +qi++l++ke+ l ++nk+Lr 
  GRMZM2G070034_P01  78 VNNKTVQQDIQQVKADAVSLASRLEALEKTKRMFLGENLEECSIEELHNLEVKLAKSLHVIRGKKTQLLEQQISKLKEKERTLLQDNKELRD 169
                        4455778899*********************************************************************************9 PP

              K-box  97 kl 98 
                        k 
  GRMZM2G070034_P01 170 KQ 171
                        85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.3E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.272161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.09E-31385IPR002100Transcription factor, MADS-box
PRINTSPR004048.7E-31323IPR002100Transcription factor, MADS-box
CDDcd002652.62E-40374No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004048.7E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004048.7E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.9E-2384170IPR002487Transcription factor, K-box
PROSITE profilePS5129713.25987177IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MVRGKTELKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLVVFSP RGKLYEFASA  60
ASLQKTIDRY RTYTRENVNN KTVQQDIQQV KADAVSLASR LEALEKTKRM FLGENLEECS  120
IEELHNLEVK LAKSLHVIRG KKTQLLEQQI SKLKEKERTL LQDNKELRDK QRNLQSPPEA  180
PPDLNRCVPP WPRSLPAPSN DMDVETELYI GLPGRERSSN RDSD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D2e-16373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C2e-16373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B2e-16373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A2e-16373271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J2e-16373271Myocyte-specific enhancer factor 2A
3p57_I2e-16373271Myocyte-specific enhancer factor 2A
3p57_D2e-16373271Myocyte-specific enhancer factor 2A
3p57_C2e-16373271Myocyte-specific enhancer factor 2A
3p57_B2e-16373271Myocyte-specific enhancer factor 2A
3p57_A2e-16373271Myocyte-specific enhancer factor 2A
3kov_J2e-16373271Myocyte-specific enhancer factor 2A
3kov_I2e-16373271Myocyte-specific enhancer factor 2A
3kov_B2e-16373271Myocyte-specific enhancer factor 2A
3kov_A2e-16373271Myocyte-specific enhancer factor 2A
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Zm.158300.0endosperm| meristem| ovary| silk
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasGRMZM2G070034
Cis-element ? help Back to Top
SourceLink
PlantRegMapGRMZM2G070034_P01
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0648230.0BT064823.1 Zea mays full-length cDNA clone ZM_BFb0180I10 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001168784.11e-164uncharacterized protein LOC100382583
SwissprotA2Z9Q71e-110MAD56_ORYSI; MADS-box transcription factor 56
TrEMBLC0P9541e-164C0P954_MAIZE; MADS transcription factor
STRINGGRMZM2G070034_P011e-164(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.18e-68AGAMOUS-like 20